PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07275
Common NameKK1_007478
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 802aa    MW: 89732.4 Da    PI: 5.8867
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07275genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.8e-29563613252
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  C.cajan_07275 563 EKSISLEVLQRYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 613
                    799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.677552633IPR003035RWP-RK domain
PfamPF020421.4E-25566613IPR003035RWP-RK domain
SuperFamilySSF542774.58E-24705792No hitNo description
PROSITE profilePS5174525.465707789IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.5E-27707788No hitNo description
SMARTSM006661.7E-27707789IPR000270PB1 domain
PfamPF005642.7E-19707788IPR000270PB1 domain
CDDcd064073.84E-38708788No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
MSESEEENPD CVPRSKAEEE GGCNMDFDLE LESSWPLDHM SFVSNPMSPF LFSNTSDQPY  60
SPLWAFSDGE DERHPRFPAS AFSDCHKIFS CDSNSVAEKP VENDDHKKLL PPLVPMPPVD  120
TLDGYCVIKE RMTQALRYFK ELTELNVLAQ VWAPVRNGNR FVLTTSGQPF VLDPHSNGLN  180
QYRTVSLMYM FSVDGENDGS LGLPGRVFQQ KLPEWTPNVL YYSSKEYPRR DYAQHYNVRG  240
TLALPVFEPS MQSCLGVLEL IMTSPKINYA PEVDKICKAL ETVNLRSSEI LDQPYNITLA  300
MLLNQICNEG RQNALSEILE ILTVVCETHN LPLAQTWIPC RHRSVLAQGG GLKKSCSSFD  360
GSCMGKVCMS TTDIAFYIID AHLWGFRDAC VEHHLQQGQG VAGRAFLSHN MCFCSNITQF  420
CKTDYPLVHY ALMFGLTSCF AICLRSSHTG NDDYVLEFFL PPRVTDFHEQ KTLLGSILAS  480
VKQHFQSLKI ASGVELEDCS IEIVEATIER VHTRFESIPI APSIKSPTRH DTSPNMGRNI  540
EHIPSLEAKN IKKPSERKRG KTEKSISLEV LQRYFAGSLK DAAKSLGVCP TTMKRICRQH  600
GISRWPSRKI NKVNRSLSKL KRVIESVQGA EGAFGLNSLS PSPLPIAVGS FPEPFPYPMP  660
DFASTELQEP FGGMLIEDAG LDLSPKQSMD TPNKAVTPFA ARKEMKTVTI KATYREDIIR  720
FRVPLTCGIV ELKEEVAKRL KLEVGTFDIK YLDDDHEWVL IACDADLQEC MDVSRSSGSN  780
IIRVLVHDIT SNLGSSCESS GE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606125.10.0PREDICTED: protein NLP6-like isoform X1
SwissprotQ8RWY40.0NLP6_ARATH; Protein NLP6
TrEMBLA0A151U6360.0A0A151U636_CAJCA; Uncharacterized protein
STRINGGLYMA20G29960.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein